Recombinant Campylobacter jejuni CdtB Protein, His tagged

Cat.No. : CdtB-01C
Product Overview : Recombinant Campylobacter jejuni CdtB Protein wiht His tag was expressed in E.coli.
Availability December 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Campylobacter jejuni
Source : E.coli
Tag : His
Form : Lyophilized from sterile 20mM Tris, 200mM NaCl, 2mM DTT, 5% Trehalose, 5% Mannitol
Molecular Mass : 27 kDa
AASequence : MNLENFNVGTWNLQGSSAATESKWSVSVRQLVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSRVDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGAIITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLDYAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKFAS
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Publications :
Development and Validation of a Biomarker for Diarrhea-Predominant Irritable Bowel Syndrome in Human Subjects. (2015)
Circulating Anti-cytolethal Distending Toxin B and Anti-vinculin Antibodies as Biomarkers in Community and Healthcare Populations With Functional Dyspepsia and Irritable Bowel Syndrome (2019)
Immunization with cytolethal distending toxin B produces autoantibodies to vinculin and small bowel bacterial changes in a rat model of postinfectious irritable bowel syndrome (2020)
Associations between food-specific IgG antibodies and intestinal permeability biomarkers (2022)
No difference in serum levels of B-cell activating receptor and antibodies against cytolethal distending toxin B and flagellin in post-infectious irritable bowel syndrome and chronic fatigue syndrome after Giardia infection (2022)
Cytolethal distending toxin B inoculation leads to distinct gut microtypes and IBS-D-like microRNA-mediated gene expression changes in a rodent model (2023)
Official Symbol CdtB
Synonyms CdtB

No difference in serum levels of B‐cell activating receptor and antibodies against cytolethal distending toxin B and flagellin in post‐infectious irritable bowel syndrome and chronic fatigue syndrome after Giardia infection

Journal: JGH Open: An Open Access Journal of Gastroenterology and Hepatology    PubMed ID: 35355666    Data: 2022/3/14

Authors: Kurt Hanevik, Christina Saghaug, Nina Langeland

Article Snippet:For anti‐CdtB and anti‐flagellin, the optical density (OD) values from an in‐house ELISA were recorded.For anti‐CdtB and anti‐flagellin, the optical density (OD) values from an in‐house ELISA were recorded.. ELISA plates were coated with antigens from Campylobacter jejuni CdtB (Creative BioMart, Shirley, NY, USA) at the concentration 1.2 × 10 ?3 mg/mL and FLA‐ST Ultrapure, purified flagellin from Salmonella typhimurium —TLR5 ligand at a concentration 2.5 × 10 ?4 mg/mL (InvivoGen, Toulouse, France) in boric acid buffer.. After washing and blocking with 2% bovine serum albumin and washing, wells were incubated with serum at 1:500 dilution.After washing and blocking with 2% bovine serum albumin and washing, wells were incubated with serum at 1:500 dilution.

Study of Antibodies to Cytolethal Distending Toxin B (CdtB) and Antibodies to Vinculin in Patients with Irritable Bowel Syndrome

Journal: F1000Research    Data: 2021/10/15

Authors: Maysaa El Sayed Zaki, Dina Elhammady, Asmaa Osama Bakr Osman

Article Snippet:The ELISA was used to determine the anti-CdTB of C. jejuni using the recombinant C ampylobacter CdtB protein ( https://www.creativebiomart.net/description_436265_12.htm ).. The protein was used as antigens immobilized at the wells of the 96 microplates overnight at 4 C with a concentration of 1.2 μg/mL prepared in borate buffer saline to obtain PH 8.2.The protein was used as antigens immobilized at the wells of the 96 microplates overnight at 4 C with a concentration of 1.2 μg/mL prepared in borate buffer saline to obtain PH 8.2.

Circulating Anti-cytolethal Distending Toxin B and Anti-vinculin Antibodies as Biomarkers in Community and Healthcare Populations With Functional Dyspepsia and Irritable Bowel Syndrome

Journal: Clinical and Translational Gastroenterology    PubMed ID: 31356481    Data: 2019/7/24

Authors: Nicholas J. Talley, Gerald Holtmann, Simon Keely

Article Snippet:Anti-CdtB and anti-vinculin were run on the complete set of serum samples (n = 791).Anti-CdtB and anti-vinculin were run on the complete set of serum samples (n = 791).. Enzyme-linked immunosorbent assays were performed using complete recombinant Campylobacter CdtB protein (Creative BioMart, Shirley, NY) and full-length human vinculin protein (Novoprotein, Short Hills, NJ) as antigens at a concentration of 1.2 μg/mL by Commonwealth laboratories ( ).. Antigens were immobilized overnight at 4 °C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in borate buffered saline (Medicago, Uppsala, Sweden) at a pH of 8.2.Antigens were immobilized overnight at 4 °C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in borate buffered saline (Medicago, Uppsala, Sweden) at a pH of 8.2.

Development and Validation of a Biomarker for Diarrhea-Predominant Irritable Bowel Syndrome in Human Subjects

Journal: PLoS ONE    PubMed ID: 25970536    Data: 2015/5/13

Authors: Mark Pimentel, Walter Morales, Seungil Ro

Article Snippet:ELISAs were performed using complete recombinant Campylobacter CdtB protein (Creative BioMart, Shirley, NY) and full length human vinculin protein (Novoprotein, Short Hills, NJ) as antigens at a concentration of 1.2 μg/mL.. Antigens were immobilized overnight at 4°C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in Borate Buffered Saline (BBS) (Medicago, Uppsala, Sweden) at a pH of 8.2.Antigens were immobilized overnight at 4°C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in Borate Buffered Saline (BBS) (Medicago, Uppsala, Sweden) at a pH of 8.2.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CdtB Products

Required fields are marked with *

My Review for All CdtB Products

Required fields are marked with *

0
cart-icon
0
compare icon