Recombinant Human PROC therapeutic protein PROC-P027H

Recombinant Human PROC therapeutic protein

PRODUCTS

Home / Products / Recombinant Human PROC therapeutic protein

Recombinant Human PROC therapeutic protein

PROC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PROC-P027H
Product Overview : Recombinant Human activated protein C therapeutic protein is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond.
Description : This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.
Species : Human
Molecular Mass : 55000
AA Sequence : >Heavy chainLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP>Light chainSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Gene Name : PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ]
Official Symbol : PROC
Synonyms : PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4;
Gene ID : 5624
mRNA Refseq : NM_000312
Protein Refseq : NP_000303
MIM : 612283
UniProt ID : P04070
Chromosome Location : 2q13-q14
Pathway : Cell surface interactions at the vascular wall, organism-specific biosystem; Common Pathway, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem;
Function : calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy