Recombinant Human ARSB therapeutic protein(Galsulfase)
| Cat.No. : | ARSB-P038H |
| Product Overview : | Recombinant Human N-acetylgalactosamine 4-sulfatase is a variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase of recombinant?DNA origin. It is a glycoprotein with a molecular weight of approximately 56 kD. The recombinant protein is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 495 aa |
| Description : | It is a lysosomal hydrolase that catalyzes the cleavage of the sulfate ester from terminal N-acetylgalactosamine 4-sulfate residues of GAG chondroitin 4-sulfate and dermatan sulfate. Increased catabolism of GAG in turn reduces systemic dermatan sulfate accumulation, thereby reducing the primary symptoms of MPS VI. |
| Molecular Mass : | 56 kDa |
| AA Sequence : | SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRT GLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSH ERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPE EYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWS LWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIEL LHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYN VSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVW GPWM |
| Endotoxin : | < 0.1 EU per μg of the protein |
| Purity : | >95% |
| Alias : | ASB; G4S; MPS6; Galsulfase |
| Gene Name | ARSB arylsulfatase B [ Homo sapiens ] |
| Official Symbol | ARSB |
| Synonyms | ASB; G4S; MPS6; arylsulfatase B |
| Gene ID | 411 |
| mRNA Refseq | NM_000046 |
| Protein Refseq | NP_000037 |
| MIM | 611542 |
| UniProt ID | P15848 |
| Chromosome Location | 5q14.1 |
| Pathway | CS/DS degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem |
| Function | N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity |
| ◆ Recombinant Proteins | ||
| ARSB-1862HFL | Recombinant Full Length Human ARSB Protein, C-Flag-tagged | +Inquiry |
| Arsb-3659R | Recombinant Rat Arsb, His-tagged | +Inquiry |
| ARSB-1982M | Recombinant Mouse ARSB Protein | +Inquiry |
| ARSB-1290HF | Recombinant Full Length Human ARSB Protein, GST-tagged | +Inquiry |
| ARSB-383H | Recombinant Human ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *
