"ARSB" Related Products

Expand

Recombinant Human ARSB therapeutic protein

Cat.No. : ARSB-P038H
Product Overview : Recombinant Human N-acetylgalactosamine 4-sulfatase is a variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase of recombinant?DNA origin. It is a glycoprotein with a molecular weight of approximately 56 kD. The recombinant protein is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family.
Description : It is a lysosomal hydrolase that catalyzes the cleavage of the sulfate ester from terminal N-acetylgalactosamine 4-sulfate residues of GAG chondroitin 4-sulfate and dermatan sulfate. Increased catabolism of GAG in turn reduces systemic dermatan sulfate accumulation, thereby reducing the primary symptoms of MPS VI.
Species : Human
Molecular Mass : 56 kDa
Protein length : 495 aa
AA Sequence : SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRT GLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSH ERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPE EYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWS LWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIEL LHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYN VSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVW GPWM
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Gene Name : ARSB arylsulfatase B [ Homo sapiens ]
Official Symbol : ARSB
Synonyms : ASB; G4S; MPS6; arylsulfatase B
Gene ID : 411
mRNA Refseq : NM_000046
Protein Refseq : NP_000037
MIM : 611542
UniProt ID : P15848
Chromosome Location : 5q14.1
Pathway : CS/DS degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem
Function : N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.