Recombinant Human ARSB protein, His-SUMO-tagged
Cat.No. : | ARSB-2551H |
Product Overview : | Recombinant Human ARSB protein(P15848)(37-533aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 37-533aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 72 kDa |
AA Sequence : | SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
ARSB-758M | Recombinant Mouse ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
ARSB-1080B | Recombinant Bacillus subtilis ARSB protein, His-tagged | +Inquiry |
ARSB-26104TH | Recombinant Human ARSB | +Inquiry |
ARSB-3370H | Recombinant Human ARSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Arsb-3659R | Recombinant Rat Arsb, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *
0
Inquiry Basket