Recombinant Human ARSB protein, GST-tagged
Cat.No. : | ARSB-862H |
Product Overview : | Human ARSB full-length ORF (BAG37417.1, 1 a.a. - 533 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016] |
Molecular Mass : | 85.03 kDa |
AA Sequence : | MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLMKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARSB arylsulfatase B [ Homo sapiens (human) ] |
Official Symbol | ARSB |
Synonyms | ARSB; arylsulfatase B; ASB; G4S; MPS6; arylsulfatase B; N-acetylgalactosamine-4-sulfatase; EC 3.1.6.12 |
Gene ID | 411 |
mRNA Refseq | NM_000046 |
Protein Refseq | NP_000037 |
MIM | 611542 |
UniProt ID | P15848 |
◆ Recombinant Proteins | ||
ARSB-5346H | Recombinant Human ARSB protein, His-tagged | +Inquiry |
ARSB-383H | Recombinant Human ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
ARSB-862H | Recombinant Human ARSB protein, GST-tagged | +Inquiry |
ARSB-599H | Recombinant Human ARSB protein, His-tagged | +Inquiry |
Arsb-653M | Recombinant Mouse Arsb Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *
0
Inquiry Basket