"BCHE" Related Products

Expand
Expand

Recombinant Human BCHE

Cat.No.: BCHE-2533H
Product Overview: Recombinant human butyrylcholinesterase (BChE) produced from conditioned medium of stably-transfected CHO-K1 cells is a tetramer form associated with a proline-rich attachment domain (PRAD). Each mature polypeptide contains 574 amino acids having a predicted molecular mass of approximately 65kD, but migrates with an approximate molecular mass of 280kD in non-reduced SDS gel.
Description: Butyrylcholinesterase (BCHE, or BuChE), also known as pseudocholinesterase or plasma cholinesterase) is a non-specific cholinesterase enzyme that hydrolyses many different choline esters. In humans, it is found primarily in the liver and is encoded by the BCHE gene.
Source: CHO-K1 cells
Species: Human
Form: 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity: Butyrylcholinesterase is a serine hydrolase and has a potential role in in maintaining and regulating the activity of neurotransmitter acetylcholine in the central nervous system. Recombinant human BChE protein has similar pharmacokinetic and protective properties to plasma-derived BChE and is suitable for other related function assays.
AA Sequence: EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRV GALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAI LQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD GDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKES ILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEI EFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLR AQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Purity: ≥90%, as determined by SDS-PAGE
Usage: FOR RESEARCH ONLY
Storage: The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name: BCHE butyrylcholinesterase [ Homo sapiens ]
Official Symbol: BCHE
Synonyms: E1; CHE1; CHE2; cholinesterase; acylcholine acylhydrolase; butyrylcholine esterase; choline esterase II; cholinesterase (serum) 2; cholinesterase 1; pseudocholinesterase
Gene ID: 590
mRNA Refseq: NM_000055
Protein Refseq: NP_000046
MIM: 177400
UniProt ID: P06276
Chromosome Location: 3q26.1-q26.2
Pathway: Glycerophospholipid biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem
Function: acetylcholinesterase activity; beta-amyloid binding; catalytic activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.