"BCHE" Related Products

Expand
Expand

Recombinant Human BCHE

Cat.No. : BCHE-2533H
Product Overview : Recombinant human butyrylcholinesterase (BChE) produced from conditioned medium of stably-transfected CHO-K1 cells is a tetramer form associated with a proline-rich attachment domain (PRAD). Each mature polypeptide contains 574 amino acids having a predicted molecular mass of approximately 65kD, but migrates with an approximate molecular mass of 280kD in non-reduced SDS gel.
Description : Butyrylcholinesterase (BCHE, or BuChE), also known as pseudocholinesterase or plasma cholinesterase) is a non-specific cholinesterase enzyme that hydrolyses many different choline esters. In humans, it is found primarily in the liver and is encoded by the BCHE gene.
Source : CHO-K1 cells
Species : Human
Form : 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity : Butyrylcholinesterase is a serine hydrolase and has a potential role in in maintaining and regulating the activity of neurotransmitter acetylcholine in the central nervous system. Recombinant human BChE protein has similar pharmacokinetic and protective properties to plasma-derived BChE and is suitable for other related function assays.
AA Sequence : EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRV GALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAI LQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD GDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKES ILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEI EFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLR AQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Purity : ≥90%, as determined by SDS-PAGE
Usage : FOR RESEARCH ONLY
Storage : The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name : BCHE butyrylcholinesterase [ Homo sapiens ]
Official Symbol : BCHE
Synonyms : E1; CHE1; CHE2; cholinesterase; acylcholine acylhydrolase; butyrylcholine esterase; choline esterase II; cholinesterase (serum) 2; cholinesterase 1; pseudocholinesterase
Gene ID : 590
mRNA Refseq : NM_000055
Protein Refseq : NP_000046
MIM : 177400
UniProt ID : P06276
Chromosome Location : 3q26.1-q26.2
Pathway : Glycerophospholipid biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem
Function : acetylcholinesterase activity; beta-amyloid binding; catalytic activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.