"BCHE" Related Products

Expand
Expand

Recombinant Human BCHE

Cat.No.: BCHE-2533H
Product Overview: Recombinant human butyrylcholinesterase (BChE) produced from conditioned medium of stably-transfected CHO-K1 cells is a tetramer form associated with a proline-rich attachment domain (PRAD). Each mature polypeptide contains 574 amino acids having a predicted molecular mass of approximately 65kD, but migrates with an approximate molecular mass of 280kD in non-reduced SDS gel.
Description: Butyrylcholinesterase (BCHE, or BuChE), also known as pseudocholinesterase or plasma cholinesterase) is a non-specific cholinesterase enzyme that hydrolyses many different choline esters. In humans, it is found primarily in the liver and is encoded by the BCHE gene.
Source: CHO-K1 cells
Species: Human
Form: 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity: Butyrylcholinesterase is a serine hydrolase and has a potential role in in maintaining and regulating the activity of neurotransmitter acetylcholine in the central nervous system. Recombinant human BChE protein has similar pharmacokinetic and protective properties to plasma-derived BChE and is suitable for other related function assays.
AA Sequence: EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRV GALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAI LQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD GDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKES ILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEI EFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLR AQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Purity: ≥90%, as determined by SDS-PAGE
Usage: FOR RESEARCH ONLY
Storage: The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name: BCHE butyrylcholinesterase [ Homo sapiens ]
Official Symbol: BCHE
Synonyms: E1; CHE1; CHE2; cholinesterase; acylcholine acylhydrolase; butyrylcholine esterase; choline esterase II; cholinesterase (serum) 2; cholinesterase 1; pseudocholinesterase
Gene ID: 590
mRNA Refseq: NM_000055
Protein Refseq: NP_000046
MIM: 177400
UniProt ID: P06276
Chromosome Location: 3q26.1-q26.2
Pathway: Glycerophospholipid biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem
Function: acetylcholinesterase activity; beta-amyloid binding; catalytic activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.