Active Recombinant Human BCHE
Cat.No. : | BCHE-2533H |
Product Overview : | Recombinant human butyrylcholinesterase (BChE) produced from conditioned medium of stably-transfected CHO-K1 cells is a tetramer form associated with a proline-rich attachment domain (PRAD). Each mature polypeptide contains 574 amino acids having a predicted molecular mass of approximately 65kD, but migrates with an approximate molecular mass of 280kD in non-reduced SDS gel. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Description : | Butyrylcholinesterase (BCHE, or BuChE), also known as pseudocholinesterase or plasma cholinesterase) is a non-specific cholinesterase enzyme that hydrolyses many different choline esters. In humans, it is found primarily in the liver and is encoded by the BCHE gene. |
Form : | 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA |
Bio-activity : | Butyrylcholinesterase is a serine hydrolase and has a potential role in in maintaining and regulating the activity of neurotransmitter acetylcholine in the central nervous system. Recombinant human BChE protein has similar pharmacokinetic and protective properties to plasma-derived BChE and is suitable for other related function assays. |
AA Sequence : | EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRV GALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAI LQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD GDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKES ILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEI EFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLR AQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL |
Purity : | ≥90%, as determined by SDS-PAGE |
Usage : | FOR RESEARCH ONLY |
Storage : | The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles. |
Gene Name | BCHE butyrylcholinesterase [ Homo sapiens ] |
Official Symbol | BCHE |
Synonyms | E1; CHE1; CHE2; cholinesterase; acylcholine acylhydrolase; butyrylcholine esterase; choline esterase II; cholinesterase (serum) 2; cholinesterase 1; pseudocholinesterase |
Gene ID | 590 |
mRNA Refseq | NM_000055 |
Protein Refseq | NP_000046 |
MIM | 177400 |
UniProt ID | P06276 |
Chromosome Location | 3q26.1-q26.2 |
Pathway | Glycerophospholipid biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem |
Function | acetylcholinesterase activity; beta-amyloid binding; catalytic activity |
◆ Recombinant Proteins | ||
BCHE-5350D | Recombinant Dog BCHE protein, His-tagged | +Inquiry |
BCHE-303H | Recombinant Human BCHE Protein, His-tagged | +Inquiry |
BCHE-01H | Active Recombinant Human BCHE Protein, His-Tagged | +Inquiry |
Bche-695M | Recombinant Mouse Bche Protein, MYC/DDK-tagged | +Inquiry |
BCHE-10H | Recombinant Human BCHE, His-tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCHE-2196HCL | Recombinant Human BCHE cell lysate | +Inquiry |
BCHE-2286MCL | Recombinant Mouse BCHE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCHE Products
Required fields are marked with *
My Review for All BCHE Products
Required fields are marked with *
0
Inquiry Basket