Recombinant Human CEBPG, His-tagged

Cat.No. : CEBPG-95H
Product Overview : Recombinant Human CEBP-γ His-Tagged fusion proeint produced inE.Coliis a single,non-glycosylated polypeptide chain containing amino acids 146 and having a molecular mass of 16.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CCAAT/enhancer binding protein(C/EBP) γ is a family of transcription factors all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and/or form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBP γ may cooperate with Fos to bind PRE- enhancer elements. The DNA binding domain of CEBP-γ (amino acid residues, 39-147) was purified by using conventional chromatography techniques
Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by reducing and non-reducing SDS-PAGE Coomassie.
Physical Appearance : Sterile filtered clorless solution.
Formulation : The protein (1mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Gene Name CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ]
Synonyms CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma;GPE1BP; IG/EBP-1; IG/EBP-1; C/EBP gamma; CCAAT/enhancer binding protein gamma
Gene ID 1054
mRNA Refseq NM_001806
Protein Refseq NP_001797
MIM 138972
UniProt ID P53567
Chromosome Location 19q13.2
Function double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEBPG Products

Required fields are marked with *

My Review for All CEBPG Products

Required fields are marked with *

0
cart-icon
0
compare icon