Recombinant Human CEBPG, His-tagged CEBPG-95H

Recombinant Human CEBPG, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CEBPG, His-tagged

Recombinant Human CEBPG, His-tagged

CEBPG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : CEBPG-95H
Product Overview : Recombinant Human CEBP-γ His-Tagged fusion proeint produced inE.Coliis a single,non-glycosylated polypeptide chain containing amino acids 146 and having a molecular mass of 16.5 kDa.
Description : CCAAT/enhancer binding protein(C/EBP) γ is a family of transcription factors all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and/or form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBP γ may cooperate with Fos to bind PRE- enhancer elements. The DNA binding domain of CEBP-γ (amino acid residues, 39-147) was purified by using conventional chromatography techniques
Source : EscherichiaColi.
Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by reducing and non-reducing SDS-PAGE Coomassie.
Physical Appearance : Sterile filtered clorless solution.
Formulation : The protein (1mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Gene Name : CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ]
Synonyms : CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma;GPE1BP; IG/EBP-1; IG/EBP-1; C/EBP gamma; CCAAT/enhancer binding protein gamma
Gene ID : 1054
mRNA Refseq : NM_001806
Protein Refseq : NP_001797
MIM : 138972
UniProt ID : P53567
Chromosome Location : 19q13.2
Function : double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy