Recombinant Human HIP1R, GST-tagged HIP1R-29H

Recombinant Human HIP1R, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human HIP1R, GST-tagged

Recombinant Human HIP1R, GST-tagged

HIP1R Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HIP1R-29H
Product Overview : Recombinant Human HIP1R(1 a.a. - 1068 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 145.8 kDa
AA Sequence : MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLP LPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTKISFHLKHPQF PAGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSH LYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIK PVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKL EAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLRAAQLEGERSQGLREEAERKASATEARYNKL KEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKA GELARAQEALSHTEQSKSELSSRLDTLSAEKDALSGAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQG RLAERESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGH AQYLTSLADASALVAALTRFSHLAADTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQA SLVRTPLQGILQLGQELKPKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILN SCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKY EELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIK LKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQ DHQLDKKDGIYPAQLVNY
Applications : AP, Array, ELISA, WB-Re
Usage : For research use only (RUO)
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : HIP1R huntingtin interacting protein 1 related [ Homo sapiens ]
Official Symbol : HIP1R
Synonyms : HIP3; HIP12; ILWEQ; huntingtin-interacting protein 1-related protein; HIP-12; HIP1-related protein; huntingtin interacting protein 12; huntingtin-interacting protein 12
Gene ID : 9026
mRNA Refseq : NM_003959
Protein Refseq : NP_003950
MIM : 605613
UniProt ID : O75146
Chromosome Location : 12q24
Pathway : Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
Function : actin binding; clathrin binding; phosphatidylinositol binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy