Recombinant Human NUMBL NUMBL-1410H

Recombinant Human NUMBL

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NUMBL

Recombinant Human NUMBL

NUMBL Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NUMBL-1410H
Product Overview : Recombinant Human NUMBL was expressed in E. coli.
Description : Numb-like protein is a protein that in humans is encoded by the NUMBL gene.
Source : E. coli
Species : Human
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence : MNKLRQSLRRRKPAYVPEASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKS VLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCA FAACLERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTP ATTSPGEKGEAGTPVAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKR
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name : NUMBL numb homolog (Drosophila)-like [ Homo sapiens ]
Official Symbol : NUMBL
Synonyms : NUMBL; numb homolog (Drosophila)-like; numb (Drosophila) homolog like; numb-like protein; CAG3A; CTG3a; NUMB R; NUMBLIKE; NUMBR; TNRC23; numb homolog-like; numb-related protein; NBL; NUMB-R;
Gene ID : 9253
mRNA Refseq : NM_004756
Protein Refseq : NP_004747
MIM : 604018
UniProt ID : Q9Y6R0
Chromosome Location : 19q13.13-q13.2
Pathway : Delta-Notch Signaling Pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem;
Function : protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy