Recombinant Human NUMBL

• Cat.No.: NUMBL-1410H
• Product Overview: Recombinant Human NUMBL was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Numb-like protein is a protein that in humans is encoded by the NUMBL gene.
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
• AA Sequence: MNKLRQSLRRRKPAYVPEASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKS VLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCA FAACLERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTP ATTSPGEKGEAGTPVAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKR
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: NUMBL numb homolog (Drosophila)-like [ Homo sapiens ]
• Official Symbol: NUMBL
• Synonyms: NUMBL; numb homolog (Drosophila)-like; numb (Drosophila) homolog like; numb-like protein; CAG3A; CTG3a; NUMB R; NUMBLIKE; NUMBR; TNRC23; numb homolog-like; numb-related protein; NBL; NUMB-R
• Gene ID: 9253
• mRNA Refseq: NM_004756
• Protein Refseq: NP_004747
• MIM: 604018
• UniProt ID: Q9Y6R0
• Chromosome Location: 19q13.13-q13.2
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem
• Function: protein binding