Active Recombinant Human BDNF Protein

Cat.No. : BDNF-72H
Product Overview : Active Recombinant Human BDNF Protein(P23560)(129-247 aa) was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 129-247 aa
Form : Lyophilized from a 0.22 um filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH7.4
Bio-activity : The activity is determined by the dose-dependent proliferation of C6 cell sand is typically between 0.5-1.5 ug/mL. Corresponding to a specific Activity of 1 x 10^3 units/mg.
Molecular Mass : 13.5 kDa
AASequence : HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Endotoxin : ≤10 EU/mg by the LAL method
Purity : ≥95%, by SDS-PAGE (under conditions, visualized by Coomassie staining)
Storage : 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Publications :
Gene Name BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol BDNF
Synonyms BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID 627
mRNA Refseq NM_001143805
Protein Refseq NP_001137277
MIM 113505
UniProt ID P23560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDNF Products

Required fields are marked with *

My Review for All BDNF Products

Required fields are marked with *

0
cart-icon
0
compare icon