"ACVR1C" Related Products

Expand
Expand

Recombinant Human ACVR1C, Fc-tagged, Biotinylated

Cat.No.: ACVR1C-530H
Product Overview: The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 - Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity.
Molecular Mass: Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNI TLHLPTASPNAPKLGPMESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition.
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: ACVR1C activin A receptor, type IC [ Homo sapiens ]
Official Symbol: ACVR1C
Synonyms: ACVR1C; activin A receptor, type IC; activin receptor type-1C; ACVRLK7; ALK7; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7;
Gene ID: 130399
mRNA Refseq: NM_001111031
Protein Refseq: NP_001104501
MIM: 608981
UniProt ID: Q8NER5
Chromosome Location: 2q24.2
Pathway: Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function: ATP binding; activin receptor activity, type I; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.