Active Recombinant Human AXL, Fc-tagged, Biotinylated
| Cat.No. : | AXL-537H |
| Product Overview : | The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 26-447 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity. |
| Molecular Mass : | Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
| AA Sequence : | APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLW LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTP GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWT HWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ GDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | AXL AXL receptor tyrosine kinase [ Homo sapiens ] |
| Official Symbol | AXL |
| Synonyms | AXL; AXL receptor tyrosine kinase; tyrosine-protein kinase receptor UFO; JTK11; UFO; AXL oncogene; oncogene AXL; AXL transforming sequence/gene; |
| Gene ID | 558 |
| mRNA Refseq | NM_001699 |
| Protein Refseq | NP_001690 |
| MIM | 109135 |
| UniProt ID | P30530 |
| Chromosome Location | 19q13.1 |
| Function | ATP binding; nucleotide binding; protein heterodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
| ◆ Recombinant Proteins | ||
| AXL-920H | Recombinant Human AXL Protein, DDK/His-tagged | +Inquiry |
| AXL-537H | Active Recombinant Human AXL, Fc-tagged, Biotinylated | +Inquiry |
| AXL-770H | Recombinant Human AXL protein, His-tagged | +Inquiry |
| Axl-2893H | Active Recombinant Human Axl protein, Fc-tagged | +Inquiry |
| Axl-132M | Recombinant Mouse Axl protein, His&hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AXL-2476MCL | Recombinant Mouse AXL cell lysate | +Inquiry |
| AXL-2281HCL | Recombinant Human AXL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AXL Products
Required fields are marked with *
My Review for All AXL Products
Required fields are marked with *



