"CD276" Related Products

Expand
Expand

Recombinant Human CD276, Fc-tagged, Biotinylated

Cat.No.: CD276-543H
Product Overview: The recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 - Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Inhibits anti-CD3-induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 and rabbit IgG in a functional ELISA.
Molecular Mass: Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
AA Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: CD276 CD276 molecule [ Homo sapiens ]
Official Symbol: CD276
Synonyms: CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
Gene ID: 80381
mRNA Refseq: NM_001024736
Protein Refseq: NP_001019907
MIM: 605715
UniProt ID: Q5ZPR3
Chromosome Location: 15q23-q24
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.