Recombinant Human BMPR1A, Fc-tagged BMPR1A-554H

Recombinant Human BMPR1A, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BMPR1A, Fc-tagged

Recombinant Human BMPR1A, Fc-tagged

BMPR1A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BMPR1A-554H
Product Overview : The recombinant human BMPR1A-Fc fusion protein is expressed as a 354 amino acid protein consisting of Gln24 - Ser150 region of BMPR1A (UniProt accession #P36894) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Recombinant BMPR1A protein binds human BMP2 and BMP4, and blocks BMP2/BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells).
Molecular Mass : Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLA SGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ]
Official Symbol : BMPR1A
Synonyms : BMPR1A; bone morphogenetic protein receptor, type IA; ACVRLK3; bone morphogenetic protein receptor type-1A; ALK3; CD292; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5; SKR5; 10q23del;
Gene ID : 657
mRNA Refseq : NM_004329
Protein Refseq : NP_004320
MIM : 601299
UniProt ID : P36894
Chromosome Location : 10q22.3
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Heart Development, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem;
Function : ATP binding; SMAD binding; activin receptor activity, type II; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy