"TNFSF8" Related Products

Expand
Expand
Expand

Recombinant Human TNFSF8, Fc-tagged, Biotinylated

Cat.No.: TNFSF8-570H
Product Overview: The recombinant human CD30-Fc fusion is expressed as a 585 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies with high affinity. Blocks CD30 Ligand--induced IL-6 secretion by human Hodgkin"s lymphoma cells
Molecular Mass: Calculated molecular mass (kDa): 63.6; Estimated by SDS-PAGE under reducing condition (kDa): 100-110
AA Sequence: FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDL VEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENC KEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKP QDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ]
Official Symbol: TNFSF8
Synonyms: TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144;
Gene ID: 944
mRNA Refseq: NM_001244
Protein Refseq: NP_001235
MIM: 603875
UniProt ID: P32971
Chromosome Location: 9q33
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.