Recombinant Human TNFSF8, Fc-tagged, Biotinylated TNFSF8-570H

Recombinant Human TNFSF8, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TNFSF8, Fc-tagged, Biotinylated

Recombinant Human TNFSF8, Fc-tagged, Biotinylated

TNFSF8 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TNFSF8-570H
Product Overview : The recombinant human CD30-Fc fusion is expressed as a 585 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies with high affinity. Blocks CD30 Ligand--induced IL-6 secretion by human Hodgkin"s lymphoma cells
Molecular Mass : Calculated molecular mass (kDa): 63.6; Estimated by SDS-PAGE under reducing condition (kDa): 100-110
AA Sequence : FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDL VEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENC KEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKP QDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ]
Official Symbol : TNFSF8
Synonyms : TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144;
Gene ID : 944
mRNA Refseq : NM_001244
Protein Refseq : NP_001235
MIM : 603875
UniProt ID : P32971
Chromosome Location : 9q33
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function : cytokine activity; receptor binding; tumor necrosis factor receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy