Active Recombinant Human TNFSF8, Fc-tagged, Biotinylated
Cat.No. : | TNFSF8-570H |
Product Overview : | The recombinant human CD30-Fc fusion is expressed as a 585 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 19-378 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies with high affinity. Blocks CD30 Ligand--induced IL-6 secretion by human Hodgkin"s lymphoma cells |
Molecular Mass : | Calculated molecular mass (kDa): 63.6; Estimated by SDS-PAGE under reducing condition (kDa): 100-110 |
AA Sequence : | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDL VEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENC KEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKP QDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ] |
Official Symbol | TNFSF8 |
Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
Gene ID | 944 |
mRNA Refseq | NM_001244 |
Protein Refseq | NP_001235 |
MIM | 603875 |
UniProt ID | P32971 |
Chromosome Location | 9q33 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
◆ Recombinant Proteins | ||
Tnfsf8-10626M | Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged | +Inquiry |
TNFSF8-13H | Recombinant Human TNFSF8 Protein (D234A), His-tagged | +Inquiry |
TNFSF8-18H | Recombinant Human TNFSF8 Protein (Y126A), His-tagged | +Inquiry |
Tnfsf8-2374R | Recombinant Rat Tnfsf8 protein(Gln66-Asp237) | +Inquiry |
TNFSF8-322H | Active Recombinant Human TNFSF8 Protein (Gln63-Asp234), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *