Recombinant Human CD80, His-tagged, Biotinylated CD80-581H

Recombinant Human CD80, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD80, His-tagged, Biotinylated

Recombinant Human CD80, His-tagged, Biotinylated

CD80 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD80-581H
Product Overview : The recombinant human CD80 ECD protein is expressed as a 220 amino acid protein consisting of Val35 - Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human CD28, CTLA4 and PD-L1. Induces IL-2 secretion in human T cells.
Molecular Mass : Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation.
AA Sequence : VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD80 CD80 molecule [ Homo sapiens ]
Official Symbol : CD80
Synonyms : CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1; activation B7-1 antigen; costimulatory factor CD80; CTLA-4 counter-receptor B7.1; B-lymphocyte activation antigen B7; costimulatory molecule variant IgV-CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); B7; BB1; B7-1; LAB7; CD28LG; CD28LG1;
Gene ID : 941
mRNA Refseq : NM_005191
Protein Refseq : NP_005182
MIM : 112203
UniProt ID : P33681
Chromosome Location : 3q13.3-q21
Pathway : Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem;
Function : coreceptor activity; protein binding; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy