Recombinant Human FGFR1, His-tagged, Biotinylated FGFR1-605H

Recombinant Human FGFR1, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FGFR1, His-tagged, Biotinylated

Recombinant Human FGFR1, His-tagged, Biotinylated

FGFR1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FGFR1-605H
Product Overview : The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 - Glu285 region of FGFR1 (Uniprot accession #P11362 - isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass : Calculated molecular mass (kDa): 30.8; Estimated by SDS-PAGE under reducing condition (kDa): ~55
AA Sequence : RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNP TLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAG LPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFE DAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLESTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ]
Official Symbol : FGFR1
Synonyms : FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome; FGFR1/PLAG1 fusion; proto-oncogene c-Fgr; FMS-like tyrosine kinase 2; hydroxyaryl-protein kinase; fms-related tyrosine kinase 2; heparin-binding growth factor receptor; basic fibroblast growth factor receptor 1; OGD; FLT2; KAL2; FGFBR; FLT-2; HBGFR; N-SAM; FGFR-1; bFGF-R-1; FLJ99988;
Gene ID : 2260
mRNA Refseq : NM_001174063
Protein Refseq : NP_001167534
MIM : 136350
UniProt ID : P11362
Chromosome Location : 8p12
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem;
Function : ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy