"FGFR3" Related Products

Expand
Expand

Recombinant Human FGFR3, Fc-tagged

Cat.No.: FGFR3-611H
Product Overview: The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 - Gly375 region of FGFR3 (Uniprot accession #P22607 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.05 - 0.3 μg/ml
Molecular Mass: Calculated molecular mass (kDa): 63.7; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQV LNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAAN TVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLD VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTD KELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ]
Official Symbol: FGFR3
Synonyms: FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX;
Gene ID: 2261
mRNA Refseq: NM_000142
Protein Refseq: NP_000133
MIM: 134934
UniProt ID: P22607
Chromosome Location: 4p16.3
Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGFR ligand binding and activation, organism-specific biosystem;
Function: ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; nucleotide binding; protein binding; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.