Recombinant Human FGFR4, His-tagged, Biotinylated FGFR4-613H

Recombinant Human FGFR4, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FGFR4, His-tagged, Biotinylated

Recombinant Human FGFR4, His-tagged, Biotinylated

FGFR4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FGFR4-613H
Product Overview : The recombinant human FGFR4 ECD is expressed as a 360 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass : Calculated molecular mass (kDa): 39.9; Estimated by SDS-PAGE under reducing condition (kDa): 50-60
AA Sequence : LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPED AGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVK FRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLE RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEV LYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ]
Official Symbol : FGFR4
Synonyms : FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; FGFR-4; tyrosylprotein kinase; protein-tyrosine kinase; hydroxyaryl-protein kinase; tyrosine kinase related to fibroblast growth factor receptor; TKF; MGC20292;
Gene ID : 2264
mRNA Refseq : NM_002011
Protein Refseq : NP_002002
MIM : 134935
UniProt ID : P22455
Chromosome Location : 5q33-qter
Pathway : Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR4 ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem;
Function : ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein tyrosine kinase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy