"FGFR4" Related Products

Expand
Expand

Recombinant Human FGFR4, His-tagged, Biotinylated

Cat.No.: FGFR4-613H
Product Overview: The recombinant human FGFR4 ECD is expressed as a 360 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
Bio-activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass: Calculated molecular mass (kDa): 39.9; Estimated by SDS-PAGE under reducing condition (kDa): 50-60
AA Sequence: LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPED AGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVK FRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLE RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEV LYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ]
Official Symbol: FGFR4
Synonyms: FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; FGFR-4; tyrosylprotein kinase; protein-tyrosine kinase; hydroxyaryl-protein kinase; tyrosine kinase related to fibroblast growth factor receptor; TKF; MGC20292;
Gene ID: 2264
mRNA Refseq: NM_002011
Protein Refseq: NP_002002
MIM: 134935
UniProt ID: P22455
Chromosome Location: 5q33-qter
Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR4 ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem;
Function: ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein tyrosine kinase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.