"APOE" Related Products

Expand
Expand

Recombinant Human APOE, His-tagged

Cat.No.: APOE-17H
Product Overview: Recombinant Human APOE(Lys19-His317) fussed with His tag at C-terminal was expressed in HEK293.
Description: ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport .ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma .Apolipoprotein E combines with fats (lipids) in the body to form molecules called lipoproteins and Apolipoprotein E is a major component of a specific type of lipoprotein called very low-density lipoproteins (VLDLs).
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4
AA Sequence: KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMD ETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQST EELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATV GSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQAR LKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: APOE apolipoprotein E [ Homo sapiens ]
Official Symbol: APOE
Synonyms: AD2; LPG; APO-E; LDLCQ5; apolipoprotein E; apolipoprotein E3
Gene ID: 348
mRNA Refseq: NM_000041
Protein Refseq: NP_000032
MIM: 107741
UniProt ID: P02649
Chromosome Location: 19q13.2
Pathway: Alzheimer's disease, organism-specific biosystem; Binding and Uptake of Ligands by Scavenger Receptors, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem
Function: antioxidant activity; beta-amyloid binding; cholesterol binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.