Recombinant Cynomolgus monkey APOE protein, His&Myc-tagged
Cat.No. : | APOE-4324C |
Product Overview : | Recombinant Cynomolgus monkey APOE protein(P10517)(19-317aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-317aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGVSAIRERLGPLVEQGRVRAATVGSLASQPLQERAQALGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGASTAPVPIDNH |
◆ Recombinant Proteins | ||
APOE-58M | Recombinant Mouse APOE Protein, His-tagged | +Inquiry |
APOE-382R | Recombinant Rat APOE Protein, His (Fc)-Avi-tagged | +Inquiry |
APOE-17HCy5 | Recombinant Human APOE Protein, His-tagged, Cy5 Conjugated | +Inquiry |
APOE-0636H | Recombinant Human APOE Protein (Lys19-His317), C-His-tagged | +Inquiry |
APOE-696H | Recombinant Human APOE | +Inquiry |
◆ Native Proteins | ||
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
0
Inquiry Basket