Recombinant Human DICER1, GST-tagged DICER1-4738H

Recombinant Human DICER1, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DICER1, GST-tagged

Recombinant Human DICER1, GST-tagged

DICER1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DICER1-4738H
Product Overview : Recombinant Human DICER1(1813 a.a. - 1912 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the sameprotein have been identified for this gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa):36.74
AA Sequence : ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGK GKFKGVGRSYRIAKSAAARRALRSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : DICER1 dicer 1, ribonuclease type III [ Homo sapiens ]
Official Symbol : DICER1
Synonyms : DCR1; MNG1; Dicer; HERNA; RMSE2; Dicer1e; K12H4.8-LIKE; endoribonuclease Dicer; Dicer1, Dcr-1 homolog; dicer 1, double-stranded RNA-specific endoribonuclease; helicase MOI; helicase with RNAse motif
Gene ID : 23405
mRNA Refseq : NM_177438
Protein Refseq : NP_803187
MIM : 606241
UniProt ID : Q9UPY3
Chromosome Location : 14q32.13
Pathway : Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
Function : ATP binding; deoxyribonuclease I activity; double-stranded RNA binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy