Recombinant Human DICER1, His-tagged
| Cat.No. : | DICER1-28329TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1566-1922 of Human Dicer with N terminal His tag; Predicted MWt 42 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1566-1922 a.a. |
| Description : | This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCP TRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLK IPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKA YLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKH LYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFK AVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEE KEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYY PMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERT YDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRS LKANQPQVPNS |
| Sequence Similarities : | Belongs to the helicase family. Dicer subfamily.Contains 1 Dicer dsRNA-binding fold domain.Contains 1 DRBM (double-stranded RNA-binding) domain.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 PAZ domain.Contains 2 R |
| Gene Name | DICER1 dicer 1, ribonuclease type III [ Homo sapiens ] |
| Official Symbol | DICER1 |
| Synonyms | DICER1; dicer 1, ribonuclease type III; Dicer1, Dcr 1 homolog (Drosophila); endoribonuclease Dicer; Dicer; dicer 1; double stranded RNA specific endoribonuclease; HERNA; K12H4.8 LIKE; KIAA0928; |
| Gene ID | 23405 |
| mRNA Refseq | NM_001195573 |
| Protein Refseq | NP_001182502 |
| MIM | 606241 |
| Uniprot ID | Q9UPY3 |
| Chromosome Location | 14q32.2 |
| Pathway | MicroRNA (miRNA) Biogenesis, organism-specific biosystem; Regulatory RNA pathways, organism-specific biosystem; mRNA processing, organism-specific biosystem; |
| Function | ATP binding; ATP-dependent helicase activity; double-stranded RNA binding; endonuclease activity; helicase activity; |
| ◆ Recombinant Proteins | ||
| DICER1-1120HFL | Recombinant Full Length Human DICER1 Protein, C-Flag-tagged | +Inquiry |
| DICER1-104H | Recombinant Human dicer 1, ribonuclease type III Protein, His tagged | +Inquiry |
| DICER1-3414C | Recombinant Chicken DICER1 | +Inquiry |
| DICER1-4738H | Recombinant Human DICER1, GST-tagged | +Inquiry |
| DICER1-28329TH | Recombinant Human DICER1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DICER1 Products
Required fields are marked with *
My Review for All DICER1 Products
Required fields are marked with *
