"TARBP2" Related Products

Expand

Recombinant Human TARBP2, GST-tagged

Cat.No.: TARBP2-8421H
Product Overview: Recombinant Human TARBP2(141 a.a. - 250 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: Theoretical MW (kDa):37.84
AA Sequence: RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKR NAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TARBP2 TAR (HIV-1) RNA binding protein 2 [ Homo sapiens ]
Official Symbol: TARBP2
Synonyms: LOQS; TRBP; TRBP1; TRBP2; RISC-loading complex subunit TARBP2; TAR (HIV) RNA binding protein 2; TAR (HIV) RNA-binding protein 2; TAR (HIV) RNA-binding protein TRBP1; TAR RNA binding protein 2; TAR RNA-binding protein 2; TARBP2; trans-activation responsive RNA-binding protein; trans-activation-responsive RNA-binding protein
Gene ID: 6895
mRNA Refseq: NM_134323
Protein Refseq: NP_599150
MIM: 605053
UniProt ID: Q15633
Chromosome Location: 12q13.13
Pathway: Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
Function: double-stranded RNA binding; miRNA binding; contributes_to pre-miRNA binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.