"PRKCE" Related Products

Expand
Expand

Recombinant Human PRKCE

Cat.No.: PRKCE-63H
Product Overview: Recombinant Human PRKCE (Gln580-Pro737) was expressed in E. coli.
Description: Protein Kinase C Epsilon type is a member of the serine- and threonine-specific protein kinase family that can be activated by calcium and the second messenger diacylglycerol. Protein Kinase C Epsilon contains these domains: one AGC-kinase C-terminal domain, one C2 domain, one protein kinase domain and two phorbol-ester/DAG-type zinc fingers. Protein Kinase C Epsilon phosphorylate a variety of protein targets and has been identified to participate in diverse cellular signaling pathways. It has many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Protein Kinase C Epsilon also serves as the receptor for phorbol esters, a class of tumor promoters.
Source: E. coli
Species: Human
Form: Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4
AA Sequence: MQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMT KNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPV LTLVDEAIVKQINQEEFKGFSYFGEDLMPLEHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name: PRKCE protein kinase C, epsilon [ Homo sapiens ]
Official Symbol: PRKCE
Synonyms: PKCE; nPKC-epsilon; protein kinase C epsilon type
Gene ID: 5581
mRNA Refseq: NM_005400
Protein Refseq: NP_005391
MIM: 176975
UniProt ID: Q02156
Chromosome Location: 2p21
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; DAP12 interactions, organism-specific biosystem
Function: 14-3-3 protein binding; ATP binding; actin monomer binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.