Recombinant Human PRKCE
Cat.No. : | PRKCE-63H |
Product Overview : | Recombinant Human PRKCE (Gln580-Pro737) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 580-737 a.a. |
Description : | Protein Kinase C Epsilon type is a member of the serine- and threonine-specific protein kinase family that can be activated by calcium and the second messenger diacylglycerol. Protein Kinase C Epsilon contains these domains: one AGC-kinase C-terminal domain, one C2 domain, one protein kinase domain and two phorbol-ester/DAG-type zinc fingers. Protein Kinase C Epsilon phosphorylate a variety of protein targets and has been identified to participate in diverse cellular signaling pathways. It has many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Protein Kinase C Epsilon also serves as the receptor for phorbol esters, a class of tumor promoters. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4 |
AA Sequence : | MQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMT KNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPV LTLVDEAIVKQINQEEFKGFSYFGEDLMPLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Gene Name | PRKCE protein kinase C, epsilon [ Homo sapiens ] |
Official Symbol | PRKCE |
Synonyms | PKCE; nPKC-epsilon; protein kinase C epsilon type |
Gene ID | 5581 |
mRNA Refseq | NM_005400 |
Protein Refseq | NP_005391 |
MIM | 176975 |
UniProt ID | Q02156 |
Chromosome Location | 2p21 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; DAP12 interactions, organism-specific biosystem |
Function | 14-3-3 protein binding; ATP binding; actin monomer binding |
◆ Recombinant Proteins | ||
PRKCE-62H | Recombinant Human Protein Kinase C, Epsilon, His-tagged | +Inquiry |
PRKCE-1765H | Recombinant Human PRKCE Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKCE-663H | Recombinant Human PRKCE Protein, His-tagged | +Inquiry |
PRKCE-657H | Recombinant Human PRKCE Protein, DDK-tagged | +Inquiry |
PRKCE-658H | Recombinant Human PRKCE Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCE-2857HCL | Recombinant Human PRKCE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKCE Products
Required fields are marked with *
My Review for All PRKCE Products
Required fields are marked with *
0
Inquiry Basket