"GFAP" Related Products

Expand
Expand

Recombinant Human GFAP protein, His-tagged

Cat.No.: GFAP-19H
Product Overview: Recombinant Human GFAP (Leu292-Met432) fussed with His tag at N-terminal was expressed in E. coli.
Description: Glial Fibrillary Acidic Protein (GFAP) is an intermediate filament (IF) protein which belongs to the intermediate filament family. GFAP is expressed in numerous cell types of the central nervous system (CNS), ependymal cells and phosphorylated by PKN1. GFAP, a class-III intermediate filament, is a cell-specific marker during the development of the central nervous system and distinguishes astrocytes from other glial cells. It is closely related to its non-epithelial family members, vimentin, desmin, and peripherin, which are all involved in the structure and function of the cell’s cytoskeleton. GFAP is thought to help to maintain astrocyte mechanical strength, as well as the shape of cells but its exact function remains poorly understood.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25
AA Sequence: MGSSHHHHHHSSGLVPRGSHMLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEG QSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: GFAP glial fibrillary acidic protein [ Homo sapiens ]
Official Symbol: GFAP
Synonyms: ALXDRD; glial fibrillary acidic protein
Gene ID: 2670
mRNA Refseq: NM_002055
Protein Refseq: NP_002046
MIM: 137780
UniProt ID: P14136
Chromosome Location: 17q21
Pathway: Neural Crest Differentiation, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem; Signal Transduction, organism-specific biosystem
Function: integrin binding; kinase binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.