Recombinant Full Length Human GFAP Protein
Cat.No. : | GFAP-188HF |
Product Overview : | Recombinant full length Human GFAP (amino acids 1-432) with a N terminal proprietary tag; predicted MWt 73.59kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 432 amino acids |
Description : | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | Liquid |
Molecular Mass : | 73.590kDa inclusive of tags |
AA Sequence : | MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLA RMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRF ASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETN LRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVRE AASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GFAP glial fibrillary acidic protein [ Homo sapiens ] |
Official Symbol | GFAP |
Synonyms | GFAP; glial fibrillary acidic protein; FLJ45472; intermediate filament protein |
Gene ID | 2670 |
mRNA Refseq | NM_001131019 |
Protein Refseq | NP_001124491 |
MIM | 137780 |
UniProt ID | P14136 |
◆ Recombinant Proteins | ||
Gfap-886M | Recombinant Mouse Gfap protein, His & T7-tagged | +Inquiry |
GFAP-1307H | Recombinant Human GFAP protein, GST-tagged | +Inquiry |
Gfap-6744M | Recombinant Mouse Gfap protein | +Inquiry |
GFAP-5627H | Recombinant Human GFAP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GFAP-3210H | Recombinant Human GFAP protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GFAP-526H | Native Human GFAP protein | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFAP-5955HCL | Recombinant Human GFAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFAP Products
Required fields are marked with *
My Review for All GFAP Products
Required fields are marked with *