"PARG" Related Products

Expand

Recombinant Human PARG protein, GST-tagged

Cat.No.: PARG-125H
Product Overview: Recombinant Human PARG(357 a.a. - 467 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. Several transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.95 kDa
AA Sequence: YSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHLMRLPKAEDRRKEQWETK HQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRC
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration: >50 ug/mL as determined by microplate BCA method
Gene Name: PARG poly (ADP-ribose) glycohydrolase [ Homo sapiens ]
Official Symbol: PARG
Synonyms: PARG99; poly(ADP-ribose) glycohydrolase; mitochondrial poly(ADP-ribose) glycohydrolase; poly(ADP-ribose) glycohydrolase 60 kDa isoform
Gene ID: 850
mRNA Refseq: NM_003631
Protein Refseq: NP_003622
MIM: 603501
UniProt ID: Q86W56
Chromosome Location: 10q11.23
Pathway: Base Excision Repair, organism-specific biosystem; DNA Repair, organism-specific biosystem; POLB-Dependent Long Patch Base Excision Repair, organism-specific biosystem
Function: poly(ADP-ribose) glycohydrolase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.