Recombinant Human NOL3 protein, His-tagged NOL3-48H

Recombinant Human NOL3 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NOL3 protein, His-tagged

Recombinant Human NOL3 protein, His-tagged

NOL3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NOL3-48H
Product Overview : Recombinant Human NOL3 (Met1-Ser208) fussed with His tag was expressed in E. coli.
Description : Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
Source : E. coli
Species : Human
Tag : His
Form : Supplied as a 0.2 μm filtered solution of 25mM Tris-HCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5
AA Sequence : MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLV QGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRA SDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEP EPDFEERDESEDS
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name : NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
Official Symbol : NOL3
Synonyms : ARC; FCM; MYP; NOP; NOP30; nucleolar protein 3; muscle-enriched cytoplasmic protein; nucleolar protein of 30 kDa
Gene ID : 8996
mRNA Refseq : NM_001185057
Protein Refseq : NP_001171986
MIM : 605235
UniProt ID : O60936
Chromosome Location : 16q22.1
Function : RNA binding; calcium ion binding; caspase binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy