Recombinant Human NOL3 protein, His-tagged

• Cat.No.: NOL3-48H
• Product Overview: Recombinant Human NOL3 (Met1-Ser208) fussed with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-208 a.a.
• Description: Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
• Form: Supplied as a 0.2 μm filtered solution of 25mM Tris-HCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5
• AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLV QGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRA SDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEP EPDFEERDESEDS
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
• Official Symbol: NOL3
• Synonyms: ARC; FCM; MYP; NOP; NOP30; nucleolar protein 3; muscle-enriched cytoplasmic protein; nucleolar protein of 30 kDa
• Gene ID: 8996
• mRNA Refseq: NM_001185057
• Protein Refseq: NP_001171986
• MIM: 605235
• UniProt ID: O60936
• Chromosome Location: 16q22.1
• Function: RNA binding; calcium ion binding; caspase binding