Recombinant Full Length Human NOL3 Protein, GST-tagged

• Cat.No.: NOL3-6689HF
• Product Overview: Human NOL3 full-length ORF ( NP_003937.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 208 amino acids
• Description: This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
• Molecular Mass: 49 kDa
• AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
• Official Symbol: NOL3
• Synonyms: NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304
• Gene ID: 8996
• mRNA Refseq: NM_001185057
• Protein Refseq: NP_001171986
• MIM: 605235
• UniProt ID: O60936