Recombinant Full Length Human NOL3 Protein, GST-tagged
| Cat.No. : | NOL3-6689HF |
| Product Overview : | Human NOL3 full-length ORF ( NP_003937.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 208 amino acids |
| Description : | This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
| Molecular Mass : | 49 kDa |
| AA Sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
| Official Symbol | NOL3 |
| Synonyms | NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304; |
| Gene ID | 8996 |
| mRNA Refseq | NM_001185057 |
| Protein Refseq | NP_001171986 |
| MIM | 605235 |
| UniProt ID | O60936 |
| ◆ Recombinant Proteins | ||
| NOL3-5971H | Recombinant Human NOL3 Protein, GST-tagged | +Inquiry |
| NOL3-5270H | Recombinant Human NOL3 Protein (Met1-Ser208) | +Inquiry |
| NOL3-48H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
| NOL3-5269H | Recombinant Human NOL3 Protein (Met1-Ser208), N-Gst tagged | +Inquiry |
| NOL3-7709H | Recombinant Human NOL3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *
