Recombinant Human LIG4 protein, GST-tagged LIG4-508H

Recombinant Human LIG4 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LIG4 protein, GST-tagged

Recombinant Human LIG4 protein, GST-tagged

LIG4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LIG4-508H
Product Overview : Recombinant Human LIG4(802 a.a. - 911 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ.
Description : The protein encoded by this gene is a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome. Alternatively spliced transcript variants encoding the same protein have been observed.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
Protein length : 802 a.a. - 911 a.a.
AA Sequence : RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFK AFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name : LIG4 ligase IV, DNA, ATP-dependent [ Homo sapiens ]
Official Symbol : LIG4
Synonyms : LIG4; ligase IV, DNA, ATP-dependent; DNA ligase 4; DNA joinase; DNA repair enzyme; polydeoxyribonucleotide synthase [ATP] 4; polynucleotide ligase; sealase; DNA ligase IV;
Gene ID : 3981
mRNA Refseq : NM_001098268
Protein Refseq : NP_001091738
MIM : 601837
UniProt ID : P49917
Chromosome Location : 13q33-q34
Pathway : 2-LTR circle formation, organism-specific biosystem; DNA Repair, organism-specific biosystem; Disease, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem;
Function : ATP binding; DNA binding; DNA ligase (ATP) activity; DNA ligase activity; DNA ligase activity; ligase activity; metal ion binding; nucleotide binding; protein C-terminus binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy