Recombinant Human TNKS2 protein, GST-tagged TNKS2-3329H

Recombinant Human TNKS2 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TNKS2 protein, GST-tagged

Recombinant Human TNKS2 protein, GST-tagged

TNKS2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TNKS2-3329H
Product Overview : Recombinant Human TNKS2(1068 a.a. - 1166 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
Protein length : 1068 a.a. - 1166 a.a.
AA Sequence : SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIY RGEQAYPEYLITYQIMRPEGMVDG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TNKS2 tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [ Homo sapiens ]
Official Symbol : TNKS2
Synonyms : TNKS2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; PARP 5b; PARP 5c; PARP5B; PARP5C; pART6; TANK2; TNKL; TNKS-2; tankyrase 2; tankyrase II; tankyrase-like protein; tankyrase-related protein; poly [ADP-ribose] polymerase 5B; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; PARP-5b; PARP-5c;
Gene ID : 80351
mRNA Refseq : NM_025235
Protein Refseq : NP_079511
MIM : 607128
UniProt ID : Q9H2K2
Chromosome Location : 10q23.3
Function : NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy