"FLT1" Related Products

Expand
Expand

Recombinant Human FLT1, Fc-tagged

Cat.No.: FLT1-616H
Product Overview: The recombinant human FLT1-Fc fusion is expressed as a 859 amino acid protein consisting of Ser27 - Arg656 region of FLT1 (Uniprot accession # P17948 - isoform 2 or soluble FLT1) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity: Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC)
Molecular Mass: Calculated molecular mass (kDa): 96.9; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
AA Sequence: SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPL DTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTL VLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSV NTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVT EEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWH PCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGT VGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSI TLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: FLT1 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) [ Homo sapiens ]
Official Symbol: FLT1
Synonyms: FLT1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FLT; vascular endothelial growth factor receptor 1; VEGFR1; FLT-1; VEGFR-1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor;
Gene ID: 2321
mRNA Refseq: NM_001159920
Protein Refseq: NP_001153392
MIM: 165070
UniProt ID: P17948
Chromosome Location: 13q12
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function: ATP binding; growth factor binding; nucleotide binding; protein binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity; vascular endothelial growth factor-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.