Active Recombinant Human KDR, Fc-tagged, Biotinylated

Cat.No. : KDR-631H
Product Overview : The recombinant human KDR/VEGFR2/CD309 extracellular or ecto-domain (ECD) Fc-fusion protein is expressed as a 756 amino acid protein consisting of Ala20 - Glu764 region of KDR and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 20-764 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC).
Molecular Mass : Calculated molecular mass (kDa): 108.9; Estimated by SDS-PAGE under reducing condition (kDa): 130-140.
AA Sequence : ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVI GNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEK RFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKL VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGITRSDQGLYTCAASSGLMTK KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSE RDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEE ECANEPSHAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGR GERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKL NATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEV SCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEK TNLESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ]
Official Symbol KDR
Synonyms KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor;
Gene ID 3791
mRNA Refseq NM_002253
Protein Refseq NP_002244
MIM 191306
UniProt ID P35968
Chromosome Location 4q11-q12
Pathway Angiogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function ATP binding; Hsp90 protein binding; growth factor binding; integrin binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDR Products

Required fields are marked with *

My Review for All KDR Products

Required fields are marked with *

0
cart-icon