Active Recombinant Human MANF, His-tagged, Biotinylated

• Cat.No.: MANF-639H
• Product Overview: The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 - Leu179 region of MANF and a C-terminal poly-Histidine tag.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 22-179 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED50 of 0.7 - 2.8 μg/ml.
• Molecular Mass: Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation.
• AA Sequence: LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHH IPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAP KAASARTDLSTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: MANF mesencephalic astrocyte-derived neurotrophic factor [ Homo sapiens ]
• Official Symbol: MANF
• Synonyms: MANF; mesencephalic astrocyte-derived neurotrophic factor; arginine rich, mutated in early stage tumors , ARMET; ARP; arginine-rich, mutated in early stage tumors; ARMET; MGC142148; MGC142150
• Gene ID: 7873
• mRNA Refseq: NM_006010
• Protein Refseq: NP_006001
• MIM: 601916
• UniProt ID: P55145
• Chromosome Location: 3p21.1
• Function: growth factor activity; molecular_function