Recombinant Human MANF, His-tagged, Biotinylated MANF-639H

Recombinant Human MANF, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MANF, His-tagged, Biotinylated

Recombinant Human MANF, His-tagged, Biotinylated

MANF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MANF-639H
Product Overview : The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 - Leu179 region of MANF and a C-terminal poly-Histidine tag.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED50 of 0.7 - 2.8 μg/ml.
Molecular Mass : Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation.
AA Sequence : LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHH IPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAP KAASARTDLSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : MANF mesencephalic astrocyte-derived neurotrophic factor [ Homo sapiens ]
Official Symbol : MANF
Synonyms : MANF; mesencephalic astrocyte-derived neurotrophic factor; arginine rich, mutated in early stage tumors , ARMET; ARP; arginine-rich, mutated in early stage tumors; ARMET; MGC142148; MGC142150;
Gene ID : 7873
mRNA Refseq : NM_006010
Protein Refseq : NP_006001
MIM : 601916
UniProt ID : P55145
Chromosome Location : 3p21.1
Function : growth factor activity; molecular_function;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy