"NCR3" Related Products

Expand
Expand

Recombinant Human NCR3, Fc-tagged, Biotinylated

Cat.No.: NCR3-643H
Product Overview: The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 - Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds to its ligand B7-H6 in a functional ELISA and blocks B7-H6-induced IFN-γ secretion by NK cells.
Molecular Mass: Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~50
AA Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAE LHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >90% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
Official Symbol: NCR3
Synonyms: NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID: 259197
mRNA Refseq: NM_001145466
Protein Refseq: NP_001138938
MIM: 611550
UniProt ID: O14931
Chromosome Location: 6p21.3
Pathway: Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.