"CADM3" Related Products

Expand
Expand
Expand

Recombinant Human CADM3, Fc-tagged, Biotinylated

Cat.No.: CADM3-644H
Product Overview: The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 - Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Immobilized NECL1 protein supports the adhesion of C6 rat brain glial cells and enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecular Mass: Calculated molecular mass (kDa): 59.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
AA Sequence: NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISIS NVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQEL HGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPS PVPSSSSTYHASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: CADM3 cell adhesion molecule 3 [ Homo sapiens ]
Official Symbol: CADM3
Synonyms: CADM3; cell adhesion molecule 3; IGSF4B, immunoglobulin superfamily, member 4B; BIgR; FLJ10698; Necl 1; NECL1; nectin like 1; SynCAM3; TSLL1; TSLC1-like 1; nectin-like 1; TSLC1-like protein 1; nectin-like protein 1; brain immunoglobulin receptor; synaptic cell adhesion molecule 3; immunoglobulin superfamily member 4B; immunoglobulin superfamily, member 4B; dendritic cell nectin-like protein 1 short isoform; IGSF4B; Necl-1; synCAM3;
Gene ID: 57863
mRNA Refseq: NM_001127173
Protein Refseq: NP_001120645
MIM: 609743
UniProt ID: Q8N126
Chromosome Location: 1q21.2-q22
Pathway: Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem;
Function: protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.