Recombinant Human CADM3, Fc-tagged, Biotinylated CADM3-644H

Recombinant Human CADM3, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CADM3, Fc-tagged, Biotinylated

Recombinant Human CADM3, Fc-tagged, Biotinylated

CADM3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CADM3-644H
Product Overview : The recombinant human NECL1-Fc fusion protein is expressed as a 535-amino acid protein consisting of Asn25 - Ala331 region of NECL1 (UniProt accession #Q8N126) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized NECL1 protein supports the adhesion of C6 rat brain glial cells and enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecular Mass : Calculated molecular mass (kDa): 59.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
AA Sequence : NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISIS NVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQEL HGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPS PVPSSSSTYHASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CADM3 cell adhesion molecule 3 [ Homo sapiens ]
Official Symbol : CADM3
Synonyms : CADM3; cell adhesion molecule 3; IGSF4B, immunoglobulin superfamily, member 4B; BIgR; FLJ10698; Necl 1; NECL1; nectin like 1; SynCAM3; TSLL1; TSLC1-like 1; nectin-like 1; TSLC1-like protein 1; nectin-like protein 1; brain immunoglobulin receptor; synaptic cell adhesion molecule 3; immunoglobulin superfamily member 4B; immunoglobulin superfamily, member 4B; dendritic cell nectin-like protein 1 short isoform; IGSF4B; Necl-1; synCAM3;
Gene ID : 57863
mRNA Refseq : NM_001127173
Protein Refseq : NP_001120645
MIM : 609743
UniProt ID : Q8N126
Chromosome Location : 1q21.2-q22
Pathway : Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem;
Function : protein homodimerization activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy