Recombinant Human CADM1, Fc-tagged CADM1-647H

Recombinant Human CADM1, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CADM1, Fc-tagged

Recombinant Human CADM1, Fc-tagged

CADM1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CADM1-647H
Product Overview : The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 - His346 region of NECL2 (UniProt accession #Q9BY67 - isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized NECL2 binds CRTAM/CD355 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 70-80
AA Sequence : QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISD EGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEV EEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELT CEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGS IRAVDHGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CADM1 cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol : CADM1
Synonyms : CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4 , TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789;
Gene ID : 23705
mRNA Refseq : NM_001098517
Protein Refseq : NP_001091987
MIM : 605686
UniProt ID : Q9BY67
Chromosome Location : 11q23.2
Pathway : Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem;
Function : PDZ domain binding; protein C-terminus binding; protein homodimerization activity; receptor binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy