Recombinant Human CADM2, Fc-tagged, Biotinylated CADM2-648H

Recombinant Human CADM2, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CADM2, Fc-tagged, Biotinylated

Recombinant Human CADM2, Fc-tagged, Biotinylated

CADM2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CADM2-648H
Product Overview : The recombinant human NECL3-Fc fusion protein is expressed as a 572-amino acid protein consisting of Gln25 - His367 region of NECL3 (UniProt accession #Q8N3J6) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecular Mass : Calculated molecular mass (kDa): 63.2; Estimated by SDS-PAGE under reducing condition (kDa): 80-65
AA Sequence : QFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSD EGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL KEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLIL TCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTL LPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CADM2 cell adhesion molecule 2 [ Homo sapiens ]
Official Symbol : CADM2
Synonyms : CADM2; cell adhesion molecule 2; IGSF4D, immunoglobulin superfamily, member 4D; Necl 3; NECL3; nectin like 3; SynCAM2; nectin-like 3; nectin-like protein 3; immunoglobulin superfamily member 4D; immunoglobulin superfamily, member 4D; IGSF4D; Necl-3; synCAM2; MGC104534; MGC138341; MGC138343;
Gene ID : 253559
mRNA Refseq : NM_001167674
Protein Refseq : NP_001161146
MIM : 609938
UniProt ID : Q8N3J6
Chromosome Location : 3p12.2
Pathway : Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy