Recombinant Human CADM4, Fc-tagged CADM4-651H

Recombinant Human CADM4, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CADM4, Fc-tagged

Recombinant Human CADM4, Fc-tagged

CADM4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CADM4-651H
Product Overview : The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 - Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized NECL4 interact heterophilically with NECL1 and NECL3. Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons.
Molecular Mass : Calculated molecular mass (kDa): 59.0; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
AA Sequence : PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDA RLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGV SSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLV LTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVE AQTSVPYASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CADM4 cell adhesion molecule 4 [ Homo sapiens ]
Official Symbol : CADM4
Synonyms : CADM4; cell adhesion molecule 4; IGSF4C, immunoglobulin superfamily, member 4C; Necl 4; nectin like 4; SynCAM4; TSLL2; TSLC1-like 2; nectin-like 4; TSLC1-like protein 2; nectin-like protein 4; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; NECL4; IGSF4C; Necl-4; synCAM4;
Gene ID : 199731
mRNA Refseq : NM_145296
Protein Refseq : NP_660339
MIM : 609744
UniProt ID : Q8NFZ8
Chromosome Location : 19q13.32

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy