Active Recombinant Human CADM4, Fc-tagged, Biotinylated
Cat.No. : | CADM4-650H |
Product Overview : | The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 - Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-324 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized NECL4 interact heterophilically with NECL1 and NECL3. Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons. |
Molecular Mass : | Calculated molecular mass (kDa): 59.0; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
AA Sequence : | PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDA RLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGV SSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLV LTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVE AQTSVPYASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CADM4 cell adhesion molecule 4 [ Homo sapiens ] |
Official Symbol | CADM4 |
Synonyms | CADM4; cell adhesion molecule 4; IGSF4C, immunoglobulin superfamily, member 4C; Necl 4; nectin like 4; SynCAM4; TSLL2; TSLC1-like 2; nectin-like 4; TSLC1-like protein 2; nectin-like protein 4; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; NECL4; IGSF4C; Necl-4; synCAM4; |
Gene ID | 199731 |
mRNA Refseq | NM_145296 |
Protein Refseq | NP_660339 |
MIM | 609744 |
UniProt ID | Q8NFZ8 |
Chromosome Location | 19q13.32 |
◆ Recombinant Proteins | ||
Cadm4-1933M | Recombinant Mouse Cadm4 Protein, Myc/DDK-tagged | +Inquiry |
Cadm4-6879M | Recombinant Mouse Cadm4 protein(Met1-Ala324), His-tagged | +Inquiry |
CADM4-746H | Recombinant Human CADM4 Protein, Fc-tagged | +Inquiry |
CADM4-6655H | Recombinant Human CADM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CADM4-747H | Recombinant Human CADM4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM4-1838MCL | Recombinant Mouse CADM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM4 Products
Required fields are marked with *
My Review for All CADM4 Products
Required fields are marked with *