Recombinant Human OSM, His-tagged, Biotinylated OSM-656H

Recombinant Human OSM, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human OSM, His-tagged, Biotinylated

Recombinant Human OSM, His-tagged, Biotinylated

OSM Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : OSM-656H
Product Overview : The recombinant human OSM is expressed as a 216-amino acid active form consisting of Ala26 - Arg220 region of(UniProt accession #P13725) and a C-terminal His-tag. Human OSM contains 2 potential N-linked glycosylation sites.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.1 - 0.3 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecular Mass : Calculated molecular mass (kDa): 24.5; Estimated by SDS-PAGE under reducing condition (kDa): ~35
AA Sequence : AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTL NATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGAS QPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : OSM oncostatin M [ Homo sapiens ]
Official Symbol : OSM
Synonyms : OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID : 5008
mRNA Refseq : NM_020530
Protein Refseq : NP_065391
MIM : 165095
UniProt ID : P13725
Chromosome Location : 22q12.2
Pathway : Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function : cytokine activity; growth factor activity; oncostatin-M receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy