"OSM" Related Products

Expand
Expand
Expand

Recombinant Human OSM, His-tagged, Biotinylated

Cat.No.: OSM-656H
Product Overview: The recombinant human OSM is expressed as a 216-amino acid active form consisting of Ala26 - Arg220 region of(UniProt accession #P13725) and a C-terminal His-tag. Human OSM contains 2 potential N-linked glycosylation sites.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.1 - 0.3 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecular Mass: Calculated molecular mass (kDa): 24.5; Estimated by SDS-PAGE under reducing condition (kDa): ~35
AA Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTL NATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGAS QPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: OSM oncostatin M [ Homo sapiens ]
Official Symbol: OSM
Synonyms: OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID: 5008
mRNA Refseq: NM_020530
Protein Refseq: NP_065391
MIM: 165095
UniProt ID: P13725
Chromosome Location: 22q12.2
Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity; growth factor activity; oncostatin-M receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.