Active Recombinant Human TNFRSF4, Fc-tagged, Biotinylated

Cat.No. : TNFRSF4-659H
Product Overview : The recombinant human OX40-Fc fusion is expressed as a 414 amino acid protein consisting of Leu29 - Ala214 region of OX40 (UniProt accession #P43489) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 29-214 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to OX40 ligand and anti-OX40/CD134 monoclonal antibodies with high affinity by ELISA. Blocks OX40 Ligand-induced signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 45.5; Estimated by SDS-PAGE under reducing condition (kDa): ~65
AA Sequence : LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTAT QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQP QETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
Official Symbol TNFRSF4
Synonyms TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor;
Gene ID 7293
mRNA Refseq NM_003327
Protein Refseq NP_003318
MIM 600315
UniProt ID P43489
Chromosome Location 1p36
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem;
Function binding; receptor activity; tumor necrosis factor-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF4 Products

Required fields are marked with *

My Review for All TNFRSF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon