Recombinant Mouse TNFRSF4 Protein

Cat.No. : TNFRSF4-682M
Product Overview : Recombinant Mouse TNFRSF4 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 272
Description : Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process; positive regulation of B cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response; negative regulation of cytokine production; and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4).
Form : Lyophilized
Molecular Mass : 23.2 kDa
AA Sequence : MYVWVQQPTALLLLALTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Mus musculus (house mouse) ]
Official Symbol TNFRSF4
Synonyms TNFRSF4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; tax-transcriptionally activated glycoprotein 1; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L;
Gene ID 22163
mRNA Refseq NM_011659
Protein Refseq NP_035789

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF4 Products

Required fields are marked with *

My Review for All TNFRSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon