Recombinant Human PDGFRA, Fc-tagged, Biotinylated PDGFRA-662H

Recombinant Human PDGFRA, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Human PDGFRA, Fc-tagged, Biotinylated

Recombinant Human PDGFRA, Fc-tagged, Biotinylated

PDGFRA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PDGFRA-662H
Product Overview : The recombinant human PDGFRA-Fc fusion is expressed as a 733 amino acid protein consisting of Gln24 - Ala528 region of PDGFRA and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human PDGF family members (PDGFA, PDGFB and PDGFC) and blocks PDGF-mediated signaling activity in fibroblast cells.
Molecular Mass : Calculated molecular mass (kDa): 82.1; Estimated by SDS-PAGE under reducing condition (kDa): 90-100
AA Sequence : QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGL YTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPAS YDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDL QWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIK PTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHY TIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILA NNVSNIITEIHPRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVASTGTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : PDGFRA platelet-derived growth factor receptor, alpha polypeptide [ Homo sapiens ]
Official Symbol : PDGFRA
Synonyms : PDGFRA; platelet-derived growth factor receptor, alpha polypeptide; platelet-derived growth factor receptor alpha; CD140a; PDGFR2; PDGFR-alpha; PDGF-R-alpha; CD140a antigen; PDGFRA/BCR fusion; CD140 antigen-like family member A; platelet-derived growth factor receptor 2; alpha-type platelet-derived growth factor receptor; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; CD140A; PDGFR-2; RHEPDGFRA; MGC74795;
Gene ID : 5156
mRNA Refseq : NM_006206
Protein Refseq : NP_006197
MIM : 173490
UniProt ID : P16234
Chromosome Location : 4q12
Pathway : ATF-2 transcription factor network, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signal transduction, organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function : ATP binding; nucleotide binding; phosphatidylinositol 3-kinase binding; platelet-derived growth factor alpha-receptor activity; platelet-derived growth factor alpha-receptor activity; platelet-derived growth factor binding; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor binding; vascular endothelial growth factor-activated receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy