Recombinant Human SIGLEC9, Fc-tagged, Biotinylated SIGLEC9-676H

Recombinant Human SIGLEC9, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SIGLEC9, Fc-tagged, Biotinylated

Recombinant Human SIGLEC9, Fc-tagged, Biotinylated

SIGLEC9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SIGLEC9-676H
Product Overview : The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 - Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized protein supports the adhesion of human red blood cells. Blocks CD329-binding to its ligand and signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 61.4; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 (probably due to glycosylation)
AA Sequence : QTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDAPVATNNPARAVWEETRDRF HLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCS VPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQN LTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHL RDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : SIGLEC9 sialic acid binding Ig-like lectin 9 [ Homo sapiens ]
Official Symbol : SIGLEC9
Synonyms : SIGLEC9; sialic acid binding Ig-like lectin 9; sialic acid-binding Ig-like lectin 9; CD329; protein FOAP-9; CDw329; FOAP-9; siglec-9; OBBP-LIKE;
Gene ID : 27180
mRNA Refseq : NM_001198558
Protein Refseq : NP_001185487
MIM : 605640
UniProt ID : Q9Y336
Chromosome Location : 19q13.3-q13.4
Function : sugar binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy